Name | PARVB antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6053 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | PARVB antibody was raised using the C terminal of PARVB corresponding to a region with amino acids HNVSFAFELMLDGGLKKPKARPEDVVNLDLKSTLRVLYNLFTKYKNVE |
Purity/Format | Affinity purified |
Blocking Peptide | PARVB Blocking Peptide |
Description | Rabbit polyclonal PARVB antibody raised against the C terminal of PARVB |
Gene | PARVB |
Supplier Page | Shop |