| Name | PARVB antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6053 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | PARVB antibody was raised using the C terminal of PARVB corresponding to a region with amino acids HNVSFAFELMLDGGLKKPKARPEDVVNLDLKSTLRVLYNLFTKYKNVE |
| Purity/Format | Affinity purified |
| Blocking Peptide | PARVB Blocking Peptide |
| Description | Rabbit polyclonal PARVB antibody raised against the C terminal of PARVB |
| Gene | PARVB |
| Supplier Page | Shop |