Name | GNAS antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1652 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | IHC WB |
Species Reactivities | Human |
Antigen | GNAS antibody was raised using the N terminal of GNAS corresponding to a region with amino acids SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | GNAS Blocking Peptide |
Description | Rabbit polyclonal GNAS antibody raised against the N terminal of GNAS |
Gene | GNAS |
Supplier Page | Shop |