| Name | POLR1B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2934 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | POLR1B antibody was raised using a synthetic peptide corresponding to a region with amino acids SDKFQVRTTGARDRVTNQPIGGRNVQGGIRFGEMERDALLAHGTSFLLHD |
| Purity/Format | Affinity purified |
| Blocking Peptide | POLR1B Blocking Peptide |
| Description | Rabbit polyclonal POLR1B antibody |
| Gene | POLR1B |
| Supplier Page | Shop |