| Name | MMP19 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4600 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Dog |
| Antigen | MMP19 antibody was raised using the N terminal of MMP19 corresponding to a region with amino acids ALRAFQEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWR |
| Purity/Format | Affinity purified |
| Blocking Peptide | MMP19 Blocking Peptide |
| Description | Rabbit polyclonal MMP19 antibody raised against the N terminal of MMP19 |
| Gene | MMP19 |
| Supplier Page | Shop |