| Name | EXOSC10 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1331 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | EXOSC10 antibody was raised using the C terminal of EXOSC10 corresponding to a region with amino acids FAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRG |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | EXOSC10 Blocking Peptide |
| Description | Rabbit polyclonal EXOSC10 antibody raised against the C terminal of EXOSC10 |
| Gene | EXOSC10 |
| Supplier Page | Shop |