Name | GNAQ antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5722 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Dog |
Antigen | GNAQ antibody was raised using a synthetic peptide corresponding to a region with amino acids DKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK |
Purity/Format | Affinity purified |
Blocking Peptide | GNAQ Blocking Peptide |
Description | Rabbit polyclonal GNAQ antibody |
Gene | GNAQ |
Supplier Page | Shop |