| Name | UBR2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2651 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | UBR2 antibody was raised using the C terminal of UBR2 corresponding to a region with amino acids QGLRRGNPLHLCKERFKKIQKLWHQHSVTEEIGHAQEANQTLVGIDWQHL |
| Purity/Format | Affinity purified |
| Blocking Peptide | UBR2 Blocking Peptide |
| Description | Rabbit polyclonal UBR2 antibody raised against the C terminal of UBR2 |
| Gene | UBR2 |
| Supplier Page | Shop |