RNASEH1 antibody

Name RNASEH1 antibody
Supplier Fitzgerald
Catalog 70R-5021
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen RNASEH1 antibody was raised using the middle region of RNASEH1 corresponding to a region with amino acids EVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED
Purity/Format Affinity purified
Blocking Peptide RNASEH1 Blocking Peptide
Description Rabbit polyclonal RNASEH1 antibody raised against the middle region of RNASEH1
Gene RNASEH1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.