| Name | PIN4 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2106 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | PIN4 antibody was raised using the N terminal of PIN4 corresponding to a region with amino acids MPMAGLLKGLVRQLERFSVQQQASKMPPKGKSGSGKAGKGGAASGSDSAD |
| Purity/Format | Affinity purified |
| Blocking Peptide | PIN4 Blocking Peptide |
| Description | Rabbit polyclonal PIN4 antibody raised against the N terminal of PIN4 |
| Gene | PIN4 |
| Supplier Page | Shop |