Name | Caldesmon 1 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3420 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Caldesmon 1 antibody was raised using the C terminal of CALD1 corresponding to a region with amino acids VLEEEEQRRKQEEADRKLREEEEKRRLKEEIERRRAEAAEKRQKMPEDGL |
Purity/Format | Affinity purified |
Blocking Peptide | Caldesmon 1 Blocking Peptide |
Description | Rabbit polyclonal Caldesmon 1 antibody raised against the C terminal of CALD1 |
Gene | CALD1 |
Supplier Page | Shop |