Name | JARID2 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5246 |
Prices | $375.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | JARID2 antibody was raised using the N terminal of JARID2 corresponding to a region with amino acids THKHVHNGHVFNGSSRSTREKEPVQKHKSKEATPAKEKHSDHRADSRREQ |
Purity/Format | Affinity purified |
Blocking Peptide | JARID2 Blocking Peptide |
Description | Rabbit polyclonal JARID2 antibody raised against the N terminal of JARID2 |
Gene | JARID2 |
Supplier Page | Shop |