| Name | SNRPD1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4701 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | SNRPD1 antibody was raised using the N terminal of SNRPD1 corresponding to a region with amino acids NGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFIL |
| Purity/Format | Affinity purified |
| Blocking Peptide | SNRPD1 Blocking Peptide |
| Description | Rabbit polyclonal SNRPD1 antibody raised against the N terminal of SNRPD1 |
| Gene | SNRPD1 |
| Supplier Page | Shop |