RBM4 antibody

• Supplier: Fitzgerald
• Catalog: 70R-4829
• Prices: $345.00
• Sizes: 50 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: RBM4 antibody was raised using the C terminal of RBM4 corresponding to a region with amino acids LQQQPLLLLLQLPLHITGGIGAPCVALQPQSPLLERATVTGMRVSCPKLQ
• Purity/Format: Affinity purified
• Blocking Peptide: RBM4 Blocking Peptide
• Description: Rabbit polyclonal RBM4 antibody raised against the C terminal of RBM4
• Gene: RBM4