SLC5A5 antibody

Name SLC5A5 antibody
Supplier Fitzgerald
Catalog 70R-6763
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen SLC5A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids TAVGGMKAVVWTDVFQVVVMLSGFWVVLARGVMLVGGPRQVLTLAQNHSR
Purity/Format Affinity purified
Blocking Peptide SLC5A5 Blocking Peptide
Description Rabbit polyclonal SLC5A5 antibody
Gene SLC5A5
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.