| Name | 2'-PDE antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2362 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | 2'-PDE antibody was raised using the middle region of 2'-Pde corresponding to a region with amino acids CLDYIFIDLNALEVEQVIPLPSHEEVTTHQALPSVSHPSDHIALVCDLKW |
| Purity/Format | Affinity purified |
| Blocking Peptide | 2-PDE Blocking Peptide |
| Description | Rabbit polyclonal 2'-PDE antibody raised against the middle region of 2'-Pde |
| Gene | PDE12 |
| Supplier Page | Shop |