ELMO3 antibody

• Supplier: Fitzgerald
• Catalog: 70R-6018
• Prices: $345.00
• Sizes: 50 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human, Mouse
• Antigen: ELMO3 antibody was raised using the middle region of ELMO3 corresponding to a region with amino acids RKLGFSNSNPAQDLERVPPGLLALDNMLYFSRNAPSAYSRFVLENSSRED
• Purity/Format: Affinity purified
• Blocking Peptide: ELMO3 Blocking Peptide
• Description: Rabbit polyclonal ELMO3 antibody raised against the middle region of ELMO3
• Gene: ELMO2