Name | PTPRR antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-7149 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Dog |
Antigen | PTPRR antibody was raised using the C terminal of PTPRR corresponding to a region with amino acids NYTIRNLVLKQGSHTQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRL |
Purity/Format | Affinity purified |
Blocking Peptide | PTPRR Blocking Peptide |
Description | Rabbit polyclonal PTPRR antibody raised against the C terminal of PTPRR |
Gene | PTPRR |
Supplier Page | Shop |