| Name | C3ORF64 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5375 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | C3ORF64 antibody was raised using the C terminal Of C3Orf64 corresponding to a region with amino acids GHHPTLGEHPKFTNYSFDVEEFMYLVLQAADHVLQHPKWPFKKKHDEL |
| Purity/Format | Affinity purified |
| Blocking Peptide | C3ORF64 Blocking Peptide |
| Description | Rabbit polyclonal C3ORF64 antibody raised against the C terminal Of C3Orf64 |
| Gene | EOGT |
| Supplier Page | Shop |