WWP2 antibody

Name WWP2 antibody
Supplier Fitzgerald
Catalog 70R-2202
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen WWP2 antibody was raised using the middle region of WWP2 corresponding to a region with amino acids SSASTDHDPLGPLPPGWEKRQDNGRVYYVNHNTRTTQWEDPRTQGMIQEP
Purity/Format Affinity purified
Blocking Peptide WWP2 Blocking Peptide
Description Rabbit polyclonal WWP2 antibody raised against the middle region of WWP2
Gene WWP2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.