PARD6B antibody

Name PARD6B antibody
Supplier Fitzgerald
Catalog 70R-2394
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen PARD6B antibody was raised using a synthetic peptide corresponding to a region with amino acids MNRSHRHGAGSGCLGTMEVKSKFGAEFRRFSLERSKPGKFEEFYGLLQHV
Purity/Format Affinity purified
Blocking Peptide PARD6B Blocking Peptide
Description Rabbit polyclonal PARD6B antibody
Gene PARD6B
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.