Name | CHD1L antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1304 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | CHD1L antibody was raised using the middle region of CHD1L corresponding to a region with amino acids DALPAAEGGSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQKTL |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | CHD1L Blocking Peptide |
Description | Rabbit polyclonal CHD1L antibody raised against the middle region of CHD1L |
Gene | CHD1L |
Supplier Page | Shop |