| Name | MICA antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6091 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | MICA antibody was raised using the N terminal of MICA corresponding to a region with amino acids LHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | MICA Blocking Peptide |
| Description | Rabbit polyclonal MICA antibody raised against the N terminal of MICA |
| Gene | MICA |
| Supplier Page | Shop |