| Name | PDE3B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6283 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | PDE3B antibody was raised using the middle region of PDE3B corresponding to a region with amino acids SRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFDFLAEFNAKANDVN |
| Purity/Format | Affinity purified |
| Blocking Peptide | PDE3B Blocking Peptide |
| Description | Rabbit polyclonal PDE3B antibody raised against the middle region of PDE3B |
| Gene | PDE3B |
| Supplier Page | Shop |