| Name | PBK antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5572 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | PBK antibody was raised using the N terminal of PBK corresponding to a region with amino acids SLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | PBK Blocking Peptide |
| Description | Rabbit polyclonal PBK antibody raised against the N terminal of PBK |
| Gene | PBK |
| Supplier Page | Shop |