| Name | ATP10D antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6896 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ATP10D antibody was raised using the C terminal of ATP10D corresponding to a region with amino acids LFTSAPPVIYGVLEKDVSAETLMQLPELYRSGQKSEAYLPHTFWITLLDA |
| Purity/Format | Affinity purified |
| Blocking Peptide | ATP10D Blocking Peptide |
| Description | Rabbit polyclonal ATP10D antibody raised against the C terminal of ATP10D |
| Gene | ATP10D |
| Supplier Page | Shop |