KCND3 antibody

Name KCND3 antibody
Supplier Fitzgerald
Catalog 70R-5186
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen KCND3 antibody was raised using the middle region of KCND3 corresponding to a region with amino acids VAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTTSLIESQHHHLLH
Purity/Format Affinity purified
Blocking Peptide KCND3 Blocking Peptide
Description Rabbit polyclonal KCND3 antibody raised against the middle region of KCND3
Gene KCND3
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.