Rhotekin antibody

Name Rhotekin antibody
Supplier Fitzgerald
Catalog 70R-2624
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen Rhotekin antibody was raised using the N terminal of RTKN corresponding to a region with amino acids DSGPPAERSPCRGRVCISDLRIPLMWKDTEYFKNKGDLHRWAVFLLLQLG
Purity/Format Affinity purified
Blocking Peptide Rhotekin Blocking Peptide
Description Rabbit polyclonal Rhotekin antibody raised against the N terminal of RTKN
Gene RTKN
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.