| Name | MED8 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3778 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | MED8 antibody was raised using the N terminal of MED8 corresponding to a region with amino acids MQREEKQLEASLDALLSQVADLKNSLGSFICKLENEYGRLTWPSVLDSFA |
| Purity/Format | Affinity purified |
| Blocking Peptide | MED8 Blocking Peptide |
| Description | Rabbit polyclonal MED8 antibody raised against the N terminal of MED8 |
| Gene | MED8 |
| Supplier Page | Shop |