| Name | LMAN2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7314 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Dog |
| Antigen | LMAN2 antibody was raised using the N terminal of LMAN2 corresponding to a region with amino acids SLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCF |
| Purity/Format | Affinity purified |
| Blocking Peptide | LMAN2 Blocking Peptide |
| Description | Rabbit polyclonal LMAN2 antibody raised against the N terminal of LMAN2 |
| Gene | LMAN2 |
| Supplier Page | Shop |