B3GAT3 antibody

Name B3GAT3 antibody
Supplier Fitzgerald
Catalog 70R-6768
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen B3GAT3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPLRAAAEQLRQKDLRISQLQAELRRPPPAPAQPPEPEALPTIYVVTPTY
Purity/Format Affinity purified
Blocking Peptide B3GAT3 Blocking Peptide
Description Rabbit polyclonal B3GAT3 antibody
Gene B3GAT3
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.