| Name | DENND1A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3137 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | DENND1A antibody was raised using the N terminal of DENND1A corresponding to a region with amino acids PGVSVHLSVHSYFTVPDTRELPSIPENRNLTEYFVAVDVNNMLHLYASML |
| Purity/Format | Affinity purified |
| Blocking Peptide | DENND1A Blocking Peptide |
| Description | Rabbit polyclonal DENND1A antibody raised against the N terminal of DENND1A |
| Gene | DENND1A |
| Supplier Page | Shop |