GNAI1 antibody

Name GNAI1 antibody
Supplier Fitzgerald
Catalog 70R-2047
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Drosophila
Antigen GNAI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids YQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLH
Purity/Format Affinity purified
Blocking Peptide GNAI1 Blocking Peptide
Description Rabbit polyclonal GNAI1 antibody
Gene GNAI1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.