| Name | FTSJD1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3874 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | FTSJD1 antibody was raised using the middle region of FTSJD1 corresponding to a region with amino acids LMYLLNCCFDQVHVFKPATSKAGNSEVYVVCLHYKGREAIHPLLSKMTLN |
| Purity/Format | Affinity purified |
| Blocking Peptide | FTSJD1 Blocking Peptide |
| Description | Rabbit polyclonal FTSJD1 antibody raised against the middle region of FTSJD1 |
| Gene | CMTR2 |
| Supplier Page | Shop |