| Name | PEO1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4802 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | PEO1 antibody was raised using the middle region of Peo1 corresponding to a region with amino acids GVFRKFATDNNCHVTLVIHPRKEDDDKELQTASIFGSAKASQEADNVLIL |
| Purity/Format | Affinity purified |
| Blocking Peptide | PEO1 Blocking Peptide |
| Description | Rabbit polyclonal PEO1 antibody raised against the middle region of Peo1 |
| Gene | CHMP1B |
| Supplier Page | Shop |