Name | KCNK10 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1533 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | KCNK10 antibody was raised using the C terminal of KCNK10 corresponding to a region with amino acids QGASEDNIINKFGSTSRLTKRKNKDLKKTLPEDVQKIYKTFRNYSLDEEK |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | KCNK10 Blocking Peptide |
Description | Rabbit polyclonal KCNK10 antibody raised against the C terminal of KCNK10 |
Gene | KCNK10 |
Supplier Page | Shop |