| Name | IL1RL1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7411 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | IL1RL1 antibody was raised using the N terminal of IL1RL1 corresponding to a region with amino acids RQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTC |
| Purity/Format | Affinity purified |
| Blocking Peptide | IL1RL1 Blocking Peptide |
| Description | Rabbit polyclonal IL1RL1 antibody raised against the N terminal of IL1RL1 |
| Gene | IL1B |
| Supplier Page | Shop |