| Name | PI4K2B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3490 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | PI4K2B antibody was raised using the middle region of PI4K2B corresponding to a region with amino acids IIGVFKPKSEEPYGQLNPKWTKYVHKVCCPCCFGRGCLIPNQGYLSEAGA |
| Purity/Format | Affinity purified |
| Blocking Peptide | PI4K2B Blocking Peptide |
| Description | Rabbit polyclonal PI4K2B antibody raised against the middle region of PI4K2B |
| Gene | PI4K2B |
| Supplier Page | Shop |