Name | GM2A antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4098 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | GM2A antibody was raised using the N terminal of GM2A corresponding to a region with amino acids MQSLMQAPLLIALGLLLAAPAQAHLKKPSQLSSFSWDNCDEGKDPAVIRS |
Purity/Format | Affinity purified |
Blocking Peptide | GM2A Blocking Peptide |
Description | Rabbit polyclonal GM2A antibody raised against the N terminal of GM2A |
Gene | GM2A |
Supplier Page | Shop |