| Name | TRAF7 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5931 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | TRAF7 antibody was raised using the N terminal of TRAF7 corresponding to a region with amino acids GPAFSAVTTITKADGTSTYKQHCRTPSSSSTLAYSPRDEEDSMPPISTPR |
| Purity/Format | Affinity purified |
| Blocking Peptide | TRAF7 Blocking Peptide |
| Description | Rabbit polyclonal TRAF7 antibody raised against the N terminal of TRAF7 |
| Gene | TRAF7 |
| Supplier Page | Shop |