| Name | CBS antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1025 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | CBS antibody was raised using the N terminal of CBS corresponding to a region with amino acids RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | CBS Blocking Peptide |
| Description | Rabbit polyclonal CBS antibody raised against the N terminal of CBS |
| Gene | CBS |
| Supplier Page | Shop |