| Name | KCNK5 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5224 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | KCNK5 antibody was raised using the C terminal of KCNK5 corresponding to a region with amino acids TFVNTEAGLSDEETSKSSLEDNLAGEESPQQGAEAKAPLNMGEFPSSSES |
| Purity/Format | Affinity purified |
| Blocking Peptide | KCNK5 Blocking Peptide |
| Description | Rabbit polyclonal KCNK5 antibody raised against the C terminal of KCNK5 |
| Gene | KCNK5 |
| Supplier Page | Shop |