| Name | SHPRH antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4679 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | SHPRH antibody was raised using the N terminal of SHPRH corresponding to a region with amino acids SIIPDVLEEDEDDPESEPEGQDIDELYHFVKQTHQQETQSIQVDVQHPAL |
| Purity/Format | Affinity purified |
| Blocking Peptide | SHPRH Blocking Peptide |
| Description | Rabbit polyclonal SHPRH antibody raised against the N terminal of SHPRH |
| Gene | SHPRH |
| Supplier Page | Shop |