MMP24 antibody

Name MMP24 antibody
Supplier Fitzgerald
Catalog 70R-6357
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen MMP24 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSCLPREGIDTALRWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVW
Purity/Format Affinity purified
Blocking Peptide MMP24 Blocking Peptide
Description Rabbit polyclonal MMP24 antibody
Gene MMP24
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.