| Name | TMEM16C antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6549 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | TMEM16C antibody was raised using the C terminal of TMEM16C corresponding to a region with amino acids AFVIAITSDYIPRFVYEYKYGPCANHVEPSENCLKGYVNNSLSFFDLSEL |
| Purity/Format | Affinity purified |
| Blocking Peptide | TMEM16C Blocking Peptide |
| Description | Rabbit polyclonal TMEM16C antibody raised against the C terminal of TMEM16C |
| Gene | ANO3 |
| Supplier Page | Shop |