Name | AGBL5 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1956 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | AGBL5 antibody was raised using the C terminal of AGBL5 corresponding to a region with amino acids NLRAWMLKHVRNSRGLSSTLNVGVNKKRGLRTPPKSHNGLPVSCSENTLS |
Purity/Format | Affinity purified |
Blocking Peptide | AGBL5 Blocking Peptide |
Description | Rabbit polyclonal AGBL5 antibody raised against the C terminal of AGBL5 |
Gene | AGBL5 |
Supplier Page | Shop |