AGBL5 antibody

Name AGBL5 antibody
Supplier Fitzgerald
Catalog 70R-1956
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen AGBL5 antibody was raised using the C terminal of AGBL5 corresponding to a region with amino acids NLRAWMLKHVRNSRGLSSTLNVGVNKKRGLRTPPKSHNGLPVSCSENTLS
Purity/Format Affinity purified
Blocking Peptide AGBL5 Blocking Peptide
Description Rabbit polyclonal AGBL5 antibody raised against the C terminal of AGBL5
Gene AGBL5
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.