LCAT antibody

Name LCAT antibody
Supplier Fitzgerald
Catalog 70R-1860
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Dog
Antigen LCAT antibody was raised using the N terminal of LCAT corresponding to a region with amino acids MGPPGSPWQWVTLLLGLLLPPAAPFWLLNVLFPPHTTPKAELSNHTRPVI
Purity/Format Total IgG Protein A purified
Blocking Peptide LCAT Blocking Peptide
Description Rabbit polyclonal LCAT antibody raised against the N terminal of LCAT
Gene LCAT
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.