UPF3B antibody

Name UPF3B antibody
Supplier Fitzgerald
Catalog 70R-4711
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen UPF3B antibody was raised using a synthetic peptide corresponding to a region with amino acids KIDRIPERDKLKDEPKIKVHRFLLQAVNQKNLLKKPEKGDEKELDKREKA
Purity/Format Affinity purified
Blocking Peptide UPF3B Blocking Peptide
Description Rabbit polyclonal UPF3B antibody
Gene UPF3B
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.