| Name | STYK1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6389 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | STYK1 antibody was raised using the C terminal of STYK1 corresponding to a region with amino acids PERLLLRPASIRADVWSFGILLYEMVTLGAPPYPEVPPTSILEHLQRRKI |
| Purity/Format | Affinity purified |
| Blocking Peptide | STYK1 Blocking Peptide |
| Description | Rabbit polyclonal STYK1 antibody raised against the C terminal of STYK1 |
| Gene | STYK1 |
| Supplier Page | Shop |