| Name | Cytokeratin 18 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1474 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | Cytokeratin 18 antibody was raised using the N terminal of KRT18 corresponding to a region with amino acids TRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSF |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | Cytokeratin 18 Blocking Peptide |
| Description | Rabbit polyclonal Cytokeratin 18 antibody raised against the N terminal of KRT18 |
| Gene | KRT18 |
| Supplier Page | Shop |