JHDM1D antibody

Name JHDM1D antibody
Supplier Fitzgerald
Catalog 70R-2404
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen JHDM1D antibody was raised using a synthetic peptide corresponding to a region with amino acids LDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDI
Purity/Format Affinity purified
Blocking Peptide JHDM1D Blocking Peptide
Description Rabbit polyclonal JHDM1D antibody
Gene KDM7A
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.